PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.21
Common NameAMTR_s00024p00053860, LOC18439206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 389aa    MW: 42253.8 Da    PI: 7.5461
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.21genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32207260255
                                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  evm_27.model.AmTr_v1.0_scaffold00024.21 207 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 260
                                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15204260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28205260IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-24207260IPR006447Myb domain, plants
PfamPF002496.7E-7208259IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MPTQGVFMEP PRSLPDLSLH ISPPNSGATP SNCSTELSLA NPSAPQENQE PHFLSLPHFQ  60
NHHQNHPHHM PSFSLLEVSE GLRPIRGIPV YHNRPFPFDD PKMGSRLYHL SYPSTSSSSL  120
SNSCSSPNPC SSSSALGLDP MATILQSSSA SQAQPFHSLR FGGLSSETLK SHHHNHHHFG  180
GVSDASSHAM RSRIVSKLPT KRSMRAPRMR WTSTLHARFV HAVELLGGHE RATPKSVLEL  240
MDVKDLTLAH VKSHLQMYRT VKTTDKPAAS SGQSDGFDSG SAGEDDFVAG NLAGSDRNLG  300
AFGFQGEVDY SSTNNSHPPA PSLWSNSSSR GPWLHTTSSD AESIRSPALL LQEKDGHHIE  360
AKGNNHDLKN PSLEFTLGRP GWHGKDRD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849441.10.0PREDICTED: transcription repressor KAN1
TrEMBLW1PLW50.0W1PLW5_AMBTC; Uncharacterized protein
STRINGVIT_04s0043g00340.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-55G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]